SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022233 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022233
Domain Number 1 Region: 332-614
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-87
Family Eukaryotic proteases 0.00000000114
Further Details:      
 
Domain Number 2 Region: 105-191
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-31
Family Kringle modules 0.0000134
Further Details:      
 
Domain Number 3 Region: 211-297
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-24
Family Kringle modules 0.0000789
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 1.45e-19
Family GLA-domain 0.0000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022233   Gene: ENSRNOG00000016325   Transcript: ENSRNOT00000022233
Sequence length 617
Comment pep:known chromosome:Rnor_5.0:3:87228705:87242228:-1 gene:ENSRNOG00000016325 transcript:ENSRNOT00000022233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHVRGLGLPGCLALAALASLVHSQHVFLAPQQALSLLQRVRRANSGFLEELRKGNLERE
CVEEQCSYEEAFEALESPQDTDVFWAKYTVCDSVRKPRETFMDCLEGRCAMDLGLNYHGN
VSVTHTGIECQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRRE
ECSIPVCGQEGRTTVKMTPRSRGSKENLSPPLGECLLERGRLYQGNLAVTTLGSPCLAWD
SLPTKTLSKYQNFDPEVKLVQNFCRNPDRDEEGAWCFVAQQPGFEYCSLNYCDEAVGEEN
HDGDESIAGRTTDAEFHTFFDERTFGLGEADCGLRPLFEKKSLTDKTEKELLDSYIDGRI
VEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLV
RIGKHSRTRYERNVEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLP
DKQTVTSLLQAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIRI
TDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPYNHRWYQMGIVSWGEGCDRNGKYGFYT
HVFRLKRWMQKVIDQHR
Download sequence
Identical sequences G3V843
ENSRNOP00000022233 NP_075213.2.100692 NP_075213.2.4139 ENSRNOP00000022233 10116.ENSRNOP00000022233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]