SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022380 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022380
Domain Number 1 Region: 412-468
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 2.09e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000445
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022380   Gene: ENSRNOG00000016703   Transcript: ENSRNOT00000022380
Sequence length 468
Comment pep:known chromosome:Rnor_5.0:6:22378517:22431362:1 gene:ENSRNOG00000016703 transcript:ENSRNOT00000022380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVNLVPKLYRSVIEDVIEGVRDLFAEEGIEEQVLKDLKKLWETKVLQSKATEDFFRNS
VQAPLFTLQLPHGLPPALQSTASLLIPAGRTLQSFTPEDLNASCAANFAFPGYPIHVPAG
MALQTASGHLYKVNVPVVVTQTSGRAEILQHPFQQVLQQLGQPSIIQTTVPTLHPCSLQA
ETEKSHRMETALQQPTVLHSTPVDRKHTENATSERRVLPGNELRPQESTQYISLPGVGFP
PQVALTESSLEPVLGASANLTQNLHGGPFTQGPPGTLRHHVLDTQLHSLRDRIYGCDSVK
QLRKIEEPSSLRVSEKSCTSERDLNIQVTDDDINEIIQIDGTGDNSSAEEGGSIRDADEN
EFPGIIEAGDLKVLEEEVDSVSNEDSTANSSDNEDHQIDALEEDPLNSGDDVSEQDAPDL
FDTDNVIVCQYDKIHRSKNRWKFYLKDGVMCFGGRDYVFAKAIGEAEW
Download sequence
Identical sequences Q641W8
ENSRNOP00000022380 10116.ENSRNOP00000022380 NP_001012136.1.100692 NP_001012136.1.4139 ENSRNOP00000022380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]