SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022382 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022382
Domain Number 1 Region: 259-516
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.01e-78
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 135-242
Classification Level Classification E-value
Superfamily Kringle-like 1.98e-32
Family Kringle modules 0.00042
Further Details:      
 
Domain Number 3 Region: 35-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000036
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 74-111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022382   Gene: ENSRNOG00000016659   Transcript: ENSRNOT00000022382
Sequence length 521
Comment pep:known chromosome:Rnor_5.0:1:284451958:284486017:1 gene:ENSRNOG00000016659 transcript:ENSRNOT00000022382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVMLVFRVLLLIALVGNSAIGLSLMPFIAPPDPDPCQSNPCEHGGDCIIRGNTFSCSC
PAPFSGSRCQTVQNKCKDNPCVQGDCLITQTPPYYRCACKYPYTGPDCSKVLPVCRPNPC
QNGGVCSRHRRRSRFSCACPDQYKGRFCEIGPDDCYVGDGYSYRGKVSRTVNQNPCLYWN
SHLLLQENYNMFMEDAETHGIADHNFCRNPDGDHKPWCFVKVNSEKVKWEYCNVEVCPES
DAANPLGSLQEPVMELPGFDSCGKTEMTEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTT
SMPQGHFCGGSLIHPCWVLTAAHCTDMSTKHLKVVLGDQDLKKTESHEQTFRVEKILKYS
QYNERDEIPHNDIALLKLKPVGGHCALESKYVKTVCLPSDPFPSGTECHISGWGVTETGE
GSRQLLDAKVKLIANALCNSRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCEKDG
TYYVYGIVSWGQECGKKPGVYTQVTKFLNWIKTTMHKEAGL
Download sequence
Identical sequences A2VD04
XP_006231695.1.100692 ENSRNOP00000022382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]