SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022621 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022621
Domain Number 1 Region: 10-191
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 5.23e-48
Family Isochorismatase-like hydrolases 0.0000678
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022621   Gene: ENSRNOG00000016829   Transcript: ENSRNOT00000022620
Sequence length 210
Comment pep:known chromosome:Rnor_5.0:1:75991121:76011769:-1 gene:ENSRNOG00000016829 transcript:ENSRNOT00000022620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARASLGRIFPESSILFLCDMQEKLRDRVLYFPQIVSMAARMLKVARILDVPVLLTEH
YPQGLGPTVPELGAQGVRTMSKTSFSMVPPLQQELDKLPQLKSVLLCGIETQVCILNTAL
DLLDRGLQVHVAVDACSSQSEMNRLVALARMQHSGVFLSTSEALTLQLIKDAAHPQFKEI
QKILKEPVPEIGLLGFFQGMNNPLLPNSRP
Download sequence
Identical sequences Q5U3Z3
10116.ENSRNOP00000022621 ENSRNOP00000022621 NP_001008368.1.100692 NP_001008368.1.4139 ENSRNOP00000022621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]