SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022679 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022679
Domain Number 1 Region: 464-662
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.06e-55
Family Hemopexin-like domain 0.00000000797
Further Details:      
 
Domain Number 2 Region: 88-218,391-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.23e-36
Family Matrix metalloproteases, catalytic domain 0.00000037
Further Details:      
 
Domain Number 3 Region: 337-393
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 0.0000733
Further Details:      
 
Domain Number 4 Region: 277-334
Classification Level Classification E-value
Superfamily Kringle-like 4e-21
Family Fibronectin type II module 0.0000663
Further Details:      
 
Domain Number 5 Region: 221-276
Classification Level Classification E-value
Superfamily Kringle-like 6e-20
Family Fibronectin type II module 0.0000528
Further Details:      
 
Domain Number 6 Region: 42-107
Classification Level Classification E-value
Superfamily PGBD-like 3.45e-19
Family MMP N-terminal domain 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022679   Gene: ENSRNOG00000016695   Transcript: ENSRNOT00000022679
Sequence length 662
Comment pep:known chromosome:Rnor_5.0:19:26630488:26658966:-1 gene:ENSRNOG00000016695 transcript:ENSRNOT00000022679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARLVWGVLVGPLRVLCVLCCLLGHAIAAPSPIIKFPGDVSPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRSDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSNDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATISKESKIKQDPVLNAPPTHLLPLSSGN
EYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFSGDKFWRYNEVKKKM
DPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
Download sequence
Identical sequences ENSRNOP00000022679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]