SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022965 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022965
Domain Number 1 Region: 4-129
Classification Level Classification E-value
Superfamily Histone-fold 1.65e-47
Family Nucleosome core histones 0.00000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022965   Gene: ENSRNOG00000022146   Transcript: ENSRNOT00000022965
Sequence length 130
Comment pep:known chromosome:Rnor_5.0:17:45481622:45482014:-1 gene:ENSRNOG00000022146 transcript:ENSRNOT00000022965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLYKGNYSERVGASAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKSKGK
Download sequence
Identical sequences Q6I8Q6
NP_001019453.1.100692 NP_001019453.1.4139 10116.ENSRNOP00000022965 ENSRNOP00000022965 ENSRNOP00000022965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]