SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022977 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022977
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily UBC-like 4.35e-50
Family UBC-related 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022977   Gene: ENSRNOG00000016930   Transcript: ENSRNOT00000022977
Sequence length 223
Comment pep:known chromosome:Rnor_5.0:1:75951968:75956026:-1 gene:ENSRNOG00000016930 transcript:ENSRNOT00000022977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF
RMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLL
IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGACSTSSGRAEASRDLASGASASS
TDPMTPGVLGGAEGPMAKKHAGERDKKLAAKKKLDKKRALRRL
Download sequence
Identical sequences B5DFI8
ENSRNOP00000022977 ENSRNOP00000022977 NP_001099694.1.100692 NP_001099694.1.4139 10116.ENSRNOP00000022977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]