SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023060 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023060
Domain Number 1 Region: 120-369
Classification Level Classification E-value
Superfamily Carbonic anhydrase 6.94e-80
Family Carbonic anhydrase 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023060   Gene: ENSRNOG00000017073   Transcript: ENSRNOT00000023060
Sequence length 437
Comment pep:known chromosome:Rnor_5.0:5:63533527:63540122:1 gene:ENSRNOG00000017073 transcript:ENSRNOT00000023060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGLSPWVPLLTPAPTVQLLLLLLLLVSAHPQSLSGMQGVPSLGESSSGEDDLGVEDL
PSEEDTPGEADPPGGEDPPEVNSKARKEDSLALEDLPTPEAPENRQGSHRDEKGGGHSLW
SYGGTLLWPQVSPACAGRFQSPVDIRLELTSFCRTLQPLELLGYELQSLPELSLCNNGHT
VQLTLPPGLKMVLGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLSTAFSE
LHEALGRPGGLAVLAAFLQESPEENSAYEQLLSHLEEIAEEGSKIEIPGLDVSALLPSDL
SRYYRYEGSLTTPPCSQGVIWTVFNETVKLSAKQLHTLSVSLWGLRDSRLQLNFRATQPL
NGRTIEASFPAVADSSPEPVHVNSCLSAGDILALVFGLLFAATSIAFLLQLRRQHRHRSG
TKDGVTYSPAEMTETGA
Download sequence
Identical sequences F7FL00
ENSRNOP00000023060 NP_001101426.1.100692 NP_001101426.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]