SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023080 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023080
Domain Number 1 Region: 114-286
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.61e-52
Family NadC C-terminal domain-like 0.0000227
Further Details:      
 
Domain Number 2 Region: 9-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.16e-25
Family NadC N-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023080   Gene: ENSRNOG00000016980   Transcript: ENSRNOT00000023080
Sequence length 299
Comment pep:known chromosome:Rnor_5.0:1:205534751:205550041:-1 gene:ENSRNOG00000016980 transcript:ENSRNOT00000023080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEGLQFLLPPASLAALANSWLQEDCPGLNFASLVTGSAPAQAVLWAKSPGVLAGRPFF
DAIFTQLNCQVSWLLPEGSKLVPVVKVAEVRGPAHHLLLGERVALNTLARCSGIASAAAT
AVEVATSTGWAGHVAGTRKTTPGFRLVEKYGLLVGGAECHRYDLGGLVMVKDNHVVAAGS
MEKAVLKARQAAGFPLKVEVECSSLKEALQAAEAGADLVMLDNFKPEELHPTAATLKAKF
PNVSVEASGGVTLDNLPQFCGTNIDVISLGMLTQAAPALDFSLKLYAEGDIPVPHARRS
Download sequence
Identical sequences Q5I0M2
ENSRNOP00000023080 NP_001009646.1.100692 NP_001009646.1.4139 ENSRNOP00000023080 10116.ENSRNOP00000023080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]