SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023387 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023387
Domain Number 1 Region: 66-176
Classification Level Classification E-value
Superfamily dUTPase-like 3.66e-40
Family dUTPase-like 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023387   Gene: ENSRNOG00000017412   Transcript: ENSRNOT00000023387
Sequence length 177
Comment pep:novel chromosome:Rnor_5.0:1:51190321:51190872:1 gene:ENSRNOG00000017412 transcript:ENSRNOT00000023387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLCALLRSRLQPSLLRSLTLSSAQSLSCGGSRGVRTWSARTGPGACAGSPSSRETLAD
GVRAYAYDYTIPSMEKALVKTDIQIAVPSGCYGRVAPRSGLAVKHFIDVGAGVIDEDYRG
NVGVVLFNFGKEKFEVKKGDRIAQLIWERILYPDLEEVQTLDNTERGSGGFGSTGKN
Download sequence
Identical sequences D4A6V3
ENSRNOP00000023387 ENSRNOP00000023387 10116.ENSRNOP00000023387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]