SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023396 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023396
Domain Number 1 Region: 26-262
Classification Level Classification E-value
Superfamily CutC-like 2.48e-76
Family CutC-like 0.00000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023396   Gene: ENSRNOG00000017298   Transcript: ENSRNOT00000023396
Sequence length 266
Comment pep:known chromosome:Rnor_5.0:1:270956594:270971364:1 gene:ENSRNOG00000017298 transcript:ENSRNOT00000023396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKGISCERKQAWISSGKAGAGNGFLMEVCVDSVESAVNAERGGADRIELCSGLLEGGTT
PSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALTE
DGHIDQELCLSLVALCRPLPVTFHRDPMAALETLLTLGFERVLTSGCDSSALEGLPLIKQ
LTDQAKGRIVVMPGGGITVKNLQRILEGSGATEFHCSARSSRDSGMKFRNSSVAMGASLA
HSEYSLKVTDVTKVRTLNAIAKDVLV
Download sequence
Identical sequences D4A6T5
ENSRNOP00000023396 NP_001101995.1.100692 NP_001101995.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]