SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023854 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023854
Domain Number 1 Region: 543-631,775-806,926-1061
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000171
Family WD40-repeat 0.02
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000023854
Domain Number - Region: 40-197,405-441,503-629
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000706
Family Tricorn protease domain 2 0.025
Further Details:      
 
Domain Number - Region: 296-365
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.0128
Family Thermostable phytase (3-phytase) 0.022
Further Details:      
 
Domain Number - Region: 299-495
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0463
Family Quinoprotein alcohol dehydrogenase-like 0.14
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023854   Gene: ENSRNOG00000017724   Transcript: ENSRNOT00000023854
Sequence length 1217
Comment pep:known chromosome:Rnor_5.0:19:54224944:54262543:1 gene:ENSRNOG00000017724 transcript:ENSRNOT00000023854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFG
VIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNMFEKIHQETFGKSGCRRIVPGQF
LAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENP
MFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFF
FLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQ
IAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILFCQIADLANEDT
PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHIEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPG
KKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQ
RSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSI
GFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFP
LQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA
AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTG
EDWYVLVGVAKDLILSPRSVAGGFVYTYKLVNNGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKHIANYISGIQTIGHRVIVSDVQESFIWVRYKRNENQ
LIIFADDTYPRWVTTASLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDRG
LLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDF
FQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRT
PPEVSKKLEDIRTRYAF
Download sequence
Identical sequences B2RSV4 E9PT66 G3HAF4 Q921M3
10090.ENSMUSP00000045073 ENSMUSP00000045073 ENSMUSP00000045073 ENSRNOP00000023854 354690 NP_001099657.2.100692 NP_001099657.2.4139 NP_598714.1.92730 XP_005345729.1.66349 XP_006255682.1.100692 XP_006530581.1.92730 XP_006974162.1.50099 XP_007634477.1.28591 XP_007639948.1.69978 XP_021076054.1.100879 XP_021488213.1.76796 XP_021488214.1.76796 ENSMUSP00000045073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]