SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023973 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023973
Domain Number 1 Region: 915-1252
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.44e-114
Family Methionine synthase SAM-binding domain 0.0000000616
Further Details:      
 
Domain Number 2 Region: 9-402
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 1.11e-112
Family Homocysteine S-methyltransferase 0.0000107
Further Details:      
 
Domain Number 3 Region: 359-633
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.44e-85
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00054
Further Details:      
 
Domain Number 4 Region: 757-909
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 7.2e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000265
Further Details:      
 
Domain Number 5 Region: 653-742
Classification Level Classification E-value
Superfamily Methionine synthase domain 5.23e-27
Family Methionine synthase domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023973   Gene: ENSRNOG00000017593   Transcript: ENSRNOT00000023974
Sequence length 1253
Comment pep:known chromosome:Rnor_5.0:17:67958262:68041430:-1 gene:ENSRNOG00000017593 transcript:ENSRNOT00000023974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEENFQGQEFKDHSRPLKGNNDILSIT
QPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNKCSADVARKAAEEIT
LQTGVKRFVAGSLGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQAKGLLDGGVDILLI
ETIFDTANAKAALFALQKLFEENYASPRPIFISGTIVDKSGRTLSGQTGEAFVTSVSHSD
PLCIGLNCALGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDETPAMMAMHLKDFA
VDGLVNVVGGCCGSTPDHIREIAEAVKNCKPRVPPDSVFEGHMLLSGLEPFRIGPYTNFV
NIGERCNVAGSKKFAKLIMAGNYEEALSVAKVQVEMGAQVLDINMDDGMLDGPSAMTKFC
NFIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEEDFLEKARKIKKFG
AAVVVMAFDEEGQATETDVKVSVCTRAYHLLVEKVGFNPNDIIFDPNILTIGTGMEEHNL
YAINFIHATRVIKETLPGVRISGGLSNLSFAFRGMDAIREAMHGVFLYHAIKFGMDMGIV
NAGSLPVYDDIHKDLLQLCEDLIWNRDAEATEKLLRYAQTHGKGGKKVIQTDEWRNGSIE
ERLEYALVKGIEKHIVEDTEEARLNREKYPRPLNIIEGPLMNGMKVVGDLFGAGKMFLPQ
VIKSARVMKKAVGHLIPFMEKEREEARVLNGSVEEEDPYQGTIVLATVKGDVHDIGKNIV
GVVLGCNNFRVIDLGVMTPCDKILQAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAI
KIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDDYFEEILEE
YEDIRQDHYESLKERKYLPLSQARKHSFHIDWLSEPHPVKPTFIGTQVFEDYNLQKLVDY
IDWKPFFDVWQLRGKYPNRGFPKIFNDKAVGEEARKVYEDAQNMLNILISRKKLRARGVV
GFWPAQSVQDDIHLYAEGAVPQAAEPIATFYGLRQQAEKDSSSTDPYHCLSDFVAPLHSG
VRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAY
CGSEQLGVTDLRKLRYEGIRPAPGYPSQPDHTEKLTMWRLANIEQATGIRLTESLAMAPA
SAVSGLYFSNVKSKYFAVGKISKDQIEDYALRKNMSVAEVEKWLGPILGYDTD
Download sequence
Identical sequences G3V8A4
ENSRNOP00000023973 10116.ENSRNOP00000023973 ENSRNOP00000023973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]