SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000023989 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000023989
Domain Number 1 Region: 13-213
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.58e-23
Family Protein-L-isoaspartyl O-methyltransferase 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000023989
Domain Number - Region: 340-357
Classification Level Classification E-value
Superfamily SOCS box-like 0.0889
Family SOCS box-like 0.0098
Further Details:      
 
Domain Number - Region: 237-255
Classification Level Classification E-value
Superfamily SOCS box-like 0.0955
Family SOCS box-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000023989   Gene: ENSRNOG00000017404   Transcript: ENSRNOT00000023989
Sequence length 359
Comment pep:known chromosome:Rnor_5.0:3:181059923:181079779:1 gene:ENSRNOG00000017404 transcript:ENSRNOT00000023989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAVSAGEDNDELIDNLKEAQYIRTDLVEQAFRAIDRADYYLEEFKENAYKDLAWKHGN
IHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVTEY
AKQKLDVFIRTSDSFDKFDFCEPSFVTGNCLEIAPDCCQYDRVYCGAGVQKEHEEYMKNL
LKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLVQPCRSESGQSRLVQLPPPAV
RSLQDLARLAIRGSIKRAMRQEATRGGGLKSTPMFKRRRVRRRRMETIVFLDKEVFASRI
SNPSDDTSCEDAEEDRREVAERTLREAKPEPPVNFLRQRVLRLPLPDPLKYYLLYYREK
Download sequence
Identical sequences D3ZY20
NP_001101280.2.100692 NP_001101280.2.4139 XP_017447293.1.100692 ENSRNOP00000023989 RnR222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]