SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024000 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024000
Domain Number 1 Region: 13-496
Classification Level Classification E-value
Superfamily ALDH-like 3.14e-183
Family ALDH-like 0.0000000000000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024000   Gene: ENSRNOG00000017619   Transcript: ENSRNOT00000024000
Sequence length 501
Comment pep:known chromosome:Rnor_5.0:1:245521322:245562969:1 gene:ENSRNOG00000017619 transcript:ENSRNOT00000024000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPAQPAVPAPLANLKIQHTKIFINNEWHDSVSGKKFPVLNPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATIEAINGGKVFANAYL
SDLGGSIKALKYCAGWADKIHGQTIPSDGDIFTFTRREPIGVCGQIIPWNFPLLMFIWKI
GPALSCGNTVVVKPAEQTPLTALHMASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVD
KVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQG
QCCVAASRIFVEESVYDEFVRKSVERAKKYVLGNPLTQGINQGPQIDKEQHDKILDLIES
GKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDDVIKR
ANNTTYGLAAGVFTKDLDRAITVSSALQAGVVWVNCYMILSAQCPFGGFKMSGNGRELGE
HGLYEYTELKTVAMKISQKNS
Download sequence
Identical sequences P51647
NP_071852.2.100692 NP_071852.2.4139 ENSRNOP00000024000 10116.ENSRNOP00000024000 ENSRNOP00000024000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]