SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024093 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024093
Domain Number 1 Region: 15-490
Classification Level Classification E-value
Superfamily ALDH-like 7.46e-141
Family ALDH-like 0.00000000000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024093   Gene: ENSRNOG00000017878   Transcript: ENSRNOT00000024093
Sequence length 495
Comment pep:known_by_projection chromosome:Rnor_5.0:1:247847960:247887886:-1 gene:ENSRNOG00000017878 transcript:ENSRNOT00000024093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPAQPEVPAPLDNLKIQHTKIFINNEWHDSVSHEKFPVINPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDHLLLATMESMNAGIFTHAYML
DTEVSIKALKYFAGWADKIHGQTIPSDGDFTYTRREHIGVCGQIIPWNGPLVSFIWKIGP
ALSCGTVISFEIKFLICLLFVSLLQAGFPPGVVNVVPGYGPTAGAAISSHMDIDKVSFTG
STEVGPFFGTISRPSYSLKKLLNDLKYFFSHVNVSFAVDSAVEFAHQGVFFHQGQICVAA
SRLFVEESIYDEFVRRSVERAKKYVLGNPLDSGMSQGPQIDKEQHVKILDLIESGKKEGA
KLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSIDEVIKRANNTPY
GLAAGVFTKDLDRAITVSSALQAGTVWVNCYLALSVQCPFGGFKMSGNGREMGEQGVYEY
TELKTVAMKISQKNS
Download sequence
Identical sequences ENSRNOP00000024093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]