SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024126 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024126
Domain Number 1 Region: 8-127
Classification Level Classification E-value
Superfamily Cgl1923-like 0.0000000034
Family Cgl1923-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024126   Gene: ENSRNOG00000017729   Transcript: ENSRNOT00000024126
Sequence length 264
Comment pep:known chromosome:Rnor_5.0:18:62579926:62594539:1 gene:ENSRNOG00000017729 transcript:ENSRNOT00000024126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPCGESVPDLKNFTLLMPAVSVGNVGQLAIDLIISTLNMCKIGYFYTDCLVPMVGNNP
YATEEEDWNELSINAEVYSLPSKKLVVLQLRSIFIKYKSKSFCEKLLAWAESSCCARIIV
LSSSHSYHRTDVQLRSTPFRYLLTPCLQKSVQNKIKSLNWLEMEKSRCIPEMSDSEFCIR
IPGGGITKTLYEESCCKEIQMAVLLKFVSEGDNIPDAVSLVEYLNEWLQIIKPCSDGPVA
SVLPWKIPSSWRLLFGSGLPPALF
Download sequence
Identical sequences D3ZAQ4
ENSRNOP00000024126 NP_001099608.2.100692 NP_001099608.2.4139 ENSRNOP00000024126 10116.ENSRNOP00000024126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]