SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024163 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024163
Domain Number 1 Region: 1460-1599
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.26e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000212
Further Details:      
 
Domain Number 2 Region: 254-358
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000593
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024163   Gene: ENSRNOG00000017883   Transcript: ENSRNOT00000024163
Sequence length 1604
Comment pep:known chromosome:Rnor_5.0:3:8736053:8796109:-1 gene:ENSRNOG00000017883 transcript:ENSRNOT00000024163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDAGGRSAAEGWRRMEAPPEGADLVPLDRYDAARAKIAANLQWICAKAYGLDNIPEDLR
DPFYIDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQAATLQGHQSVIQALSRKGIYV
MESDDTPVTDADLSQAPIKMSGHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKEL
PYDLEDAMVFWINKVNLKMREITEKEVKLKQQPLESPAHQKPGLEHAVMHCMLEPVDFAR
VVRYRREHLSARQSPYFPLLEDLMRDGSDGAALLAVVHYYCPEQMKLDDICLKEVPSMAD
SLYNIRLLREFSNEHLNKCFYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPR
DIQELKDAKTVLQQKSSRPPVPISNATKRSFLGSPAAMSPADLPPSTQPLTEGSHRYHLH
SEEPECLGKGASTFSPSHPLLPLRQKQQKVSQAEEIPDQRHRSNSLTRADGQPRGAAIAW
PDKKNRPVSQPTSFALHHAASCDVDPSSGDSISLARSISKDSLASNIIHLTPQNQPHPSA
GKTNGKSLLSNVNIEDDEEEELVAIIRTDVSPHSPEIPRTSPQAPGLVASIRSPQRQADT
LESKPDSFYLEPLMPAVLRPAKEKQIITKEDERGEGRPRTIMAKRPSEGSQPLVRKKVTG
SHGSRDLNRTFTPIPCSEFAASIDPTEVGPQSTEATGEGQPLALGRFDPVPQGQVADGFF
LHVGRAEEDEGRWYVGSQSPSSHDSEPWTILRQDSDSDVVDVEDAEQDFIGEDHPVVIPR
YAGEEESAKLQEDMKVKEHEDKDDASGRSSPCLSTTSQLSSMSMASGSVKMTSFAERKLQ
RLNSCETKSSTSSSQKTTPDASESCPAPLTTWRQKREQSPSRHSKDPASLLASELVQLHM
QLEEKRRAIEAQKKKMEALSARQRLKLGKAAFLHVVKKGKADGAPQPLRPEHFTKEFTQH
NGEDLDDGTCKTEGFLVKEEQRDLSDSQDVAFVQLHKPRDPATLHDGEKHRVISAALLED
SVGEVDVNECDLSIEKLNETISTLQQAILKISQQQEQLLMKSPTVPTSGTKNNCQDQKVK
APVHFVEPLSPTGVPGHRKPPRLGQGRNSRSGRPAELKVPKDRQQGCSRSKTPTPSVETL
PHSRSLPPSTHPRSPLDPGGELPEKCLFDSYRLHDESNHRTFGLSSCKDANIVSEQMNFK
EGLDTSVQEAELSSSAITGKEHTPMEEPLRSKASLIEVDLSDLKAPDEDGEVVGHESSLE
LGGESDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARARKQQLEAEVELKRDE
ARRKAEEDRLRKEEEKARRELIKQEYLRRKQQQALEEQGLGKPKSKPKKPRPKSVHREES
CSDSGTKCSSTPDNLSQTHSGSSLSLASAATTEPESVHSGGTPSHRVESLEALPILSRNP
SRSTDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKN
SILEELEKCDANHYIILFRDAGCQFRALYCYQPDTEEIYKLTGTGPKSITKKMIDKLYKY
SSDRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPTVPKKTQTRK
Download sequence
Identical sequences D3Z8E6
ENSRNOP00000024163 NP_001162021.1.100692 NP_001162021.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]