SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024295 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024295
Domain Number 1 Region: 328-684
Classification Level Classification E-value
Superfamily Urocanase 1.7e-128
Family Urocanase 0.00000193
Further Details:      
 
Domain Number 2 Region: 85-301
Classification Level Classification E-value
Superfamily Urocanase 6.8e-90
Family Urocanase 0.00000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024295   Gene: ENSRNOG00000043404   Transcript: ENSRNOT00000024295
Sequence length 709
Comment pep:known_by_projection chromosome:Rnor_5.0:4:186786154:186816038:1 gene:ENSRNOG00000043404 transcript:ENSRNOT00000024295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLQELCSGLPLRPLPENRGRWAGVPHAPVRTPDLSPEEEQLALRNALRYFPPDVQKLL
ALEFAQELRQFGHIYMYRFCPSIEMRAYPIEQYPCRTRAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFWLTMSYLSKMTEEQTLVMYSGHPLGLFPSSSHAPRLVITNGM
VIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAGRRYLGIEDLA
GKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALVKRHQQGWLMEVTDSLDHCIARL
RYLAVWDSEHLTLSTESRGESMTWAIQCLMPDHREARKKKEVLSLGYHGNVVDLWERLVH
ELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLSFSEAQSLMSSNPAAFKNLVQESLRRHI
SAINRLAQEKFFFWDYGNAFLLEAQRAGADVEKKGANKTEFRYPSYVQHIMGDIFSQGFG
PFRWVCTSGNPQDLTVTDHLATSVLEKAIADGVKASVKLQYMDNIRWIREAAKHQLVVGS
QARILYSDQKGRVAIAVAINQAIASGKIKAPVVLSRDHHDVSGTDSPFRETSNIYDGSAF
CADMAVQNFVGDACRGATWVALHNGGGVGWGEVINGGFGLVLDGTPEAEQKARMMLSWDV
SNGVARRCWSGNPKAYEIICQTMQENSGLVVTLPHEVADEQVLRQVLRL
Download sequence
Identical sequences ENSRNOP00000024295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]