SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024393 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024393
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.02e-52
Family Extradiol dioxygenases 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024393   Gene: ENSRNOG00000018143   Transcript: ENSRNOT00000024393
Sequence length 371
Comment pep:known chromosome:Rnor_5.0:5:139472196:139473311:-1 gene:ENSRNOG00000018143 transcript:ENSRNOT00000024393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPARRLCHIAFHVPAGQPLARDLQRIFGFQPLAVREAGGWRQLALRSGDAVFLVNEGT
GPREPLYGLDPHHSVPSATNLCFDVEDVDRAARALAARGCIMPVPPTRVRDAQGTATYTV
VSSPAGNLSLTLLQRAGYRGSFLPGFRPLPCTPGPGWVSHVDHLTLACTSGSSPTLMRWF
HNCLGFHHLPLSPGEDPELGLKVAVGSGRGGLRLTALQTLPNSTVPTLVLAESLPGLTSE
QDQVEQFLTRHGGPGLQHVGLYTPNIIDASEGMAKAGGRLLTPPEAYYQQPGKEEQILAS
GHKPSFLERQGILLDGDKDEFLLQVFTKSLFDEDTFFLELIERQGATGFGQNNIRALWQS
VQEEAARAQGT
Download sequence
Identical sequences Q5XIH9
ENSRNOP00000024393 ENSRNOP00000024393 10116.ENSRNOP00000024393 NP_001014090.1.100692 NP_001014090.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]