SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024557 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024557
Domain Number 1 Region: 154-273
Classification Level Classification E-value
Superfamily DNA clamp 2.89e-18
Family DNA polymerase processivity factor 0.012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000024557
Domain Number - Region: 36-100
Classification Level Classification E-value
Superfamily DNA clamp 0.0214
Family DNA polymerase processivity factor 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024557   Gene: ENSRNOG00000018063   Transcript: ENSRNOT00000024557
Sequence length 280
Comment pep:known chromosome:Rnor_5.0:2:84204602:84212641:-1 gene:ENSRNOG00000018063 transcript:ENSRNOT00000024557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQYNEDEYEQYCLVASLDNVRNLSTVLKAIHFKEHATCFATKNGIKVTVENAKCVQ
ANAFIQADVFQEFIIQEESVTFRINLTILLDCLSIFGSSPTPGTLTALRMCYQGYGHPLM
LFLEEGGVVTVCKITTQEPEDTLDFDFCSTNVMNKIILQSEGLREAFSELDMTGDVLQIT
VSPDKPYFRLSTFGNAGNSHLDYPKDSDLVEAFHCNKTQINRYKLSLLKPSTKALALSCK
VSIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPES
Download sequence
Identical sequences D3ZC52
ENSRNOP00000024557 NP_001099889.1.100692 NP_001099889.1.4139 XP_006232120.1.100692 XP_006232121.1.100692 ENSRNOP00000024557 10116.ENSRNOP00000024557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]