SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024719 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024719
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 6.8e-116
Family Uroporphyrinogen decarboxylase, UROD 0.00000000000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024719   Gene: ENSRNOG00000018211   Transcript: ENSRNOT00000024719
Sequence length 367
Comment pep:known chromosome:Rnor_5.0:5:139650565:139654649:-1 gene:ENSRNOG00000018211 transcript:ENSRNOT00000024719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGLQNFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLER
LRDPAAVASELGYVFQAITLTRQQLAGRVPLIGFAGAPWTLMTYMVEGGSSSTMAQAKRW
LYQKPLASHKLLGILTDALVPYLIGQVAAGAQALQLFESHAGHLGSELFSKFALPYIRDV
AKRVKAGLQKAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARERVGKTVT
LQGNLDPCALYASEEEIGRLVQQMLNDFGPQRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
Download sequence
Identical sequences B0BN55
ENSRNOP00000024719 NP_062082.1.100692 NP_062082.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]