SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024878 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024878
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.77e-33
Family PaaI/YdiI-like 0.00000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024878   Gene: ENSRNOG00000018415   Transcript: ENSRNOT00000024878
Sequence length 140
Comment pep:known chromosome:Rnor_5.0:17:44108940:44121410:1 gene:ENSRNOG00000018415 transcript:ENSRNOT00000024878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNMTQNLREIMKVMFKVPGFDRVLEKVTLVSAAPEKLICEMKVEEQHTNKFGTLHGGLT
ATLVDSISTMALMCTERGAPGVSIDMNITYMSPAKIGEEIVITAHILKQGRTLAFASVDL
TNKATGKLIAQGRHTKHLGN
Download sequence
Identical sequences D3ZA93
ENSRNOP00000024878 ENSRNOP00000024878 10116.ENSRNOP00000024878 NP_001099581.1.100692 NP_001099581.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]