SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025000 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025000
Domain Number 1 Region: 30-546
Classification Level Classification E-value
Superfamily ALDH-like 1.57e-122
Family ALDH-like 0.000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025000   Gene: ENSRNOG00000042920   Transcript: ENSRNOT00000025000
Sequence length 562
Comment pep:known chromosome:Rnor_5.0:5:161829335:161853377:1 gene:ENSRNOG00000042920 transcript:ENSRNOT00000025000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPALLRRSLLSYAWRGSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQT
EAIPCVVGDEEVWTSDVRYQLSPFNHGHKVAKFCYADKALLNKAIEAAVLARKEWDLKPV
ADRAQIFLKAADMLSGPRRAEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKFAVELE
GEQPISVPPSTNHVVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLA
SYAVYRILREAGLPPNVIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQN
LDRFRTFPRLAGECGGKNFHFVHSSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPQSLW
PQIKGRLLEEHSRIKVGNPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQC
NESVGYFVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDEKYRETLQLVDSTTSYGLTGA
VFAQDKTIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGITAHCGGPHYILRW
TSPQVIKETHKPLGDWRYSYMQ
Download sequence
Identical sequences ENSRNOP00000025000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]