SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025147 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025147
Domain Number 1 Region: 18-280
Classification Level Classification E-value
Superfamily Carbohydrate phosphatase 2.75e-79
Family Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.0000000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025147   Gene: ENSRNOG00000018516   Transcript: ENSRNOT00000025147
Sequence length 290
Comment pep:known chromosome:Rnor_5.0:18:62201776:62232717:1 gene:ENSRNOG00000018516 transcript:ENSRNOT00000025147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPNSEEEEELVQGVGPWDECFEVAVQLALRAGQIIRKALTEEKHVSTKTSAADLVTETD
HRVEDLIVSELRKRFPSHRFIAEEATASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAV
SIGFAVHQELEFGVIHHCTEERLYTGRRGQGAFCNGQRLQVSRETDLAKALVLTEIGPKR
DPDTLKVFLSNMERLLHAKAHGVRVIGSSTLALCYLASGAADAYYQFGLHCWDLAAATVI
IREAGGIVIDTSGGPLDLMSCRVVAAGTREMAVLIAQALQTINYGRDDEK
Download sequence
Identical sequences Q8CIN7
NP_757378.1.100692 NP_757378.1.4139 ENSRNOP00000025147 ENSRNOP00000025147 10116.ENSRNOP00000025147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]