SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025213 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025213
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 9.42e-37
Family Ribosomal protein L20 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025213   Gene: ENSRNOG00000018647   Transcript: ENSRNOT00000025213
Sequence length 149
Comment pep:known chromosome:Rnor_5.0:5:176723859:176728389:1 gene:ENSRNOG00000018647 transcript:ENSRNOT00000025213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFLTTRLWLRNRLTDRYWRVQEVLKHAGHFRGRKNRCYRLAVRAVTRAFVKCTNSRRLK
KRNLRTLWINRITAASQEHGLQYPAFILNLVKCQVELNRKVLVDLAIYEPKTFKSLAALA
KRRQQEGFAAALGDGKEPEGIFSRVVQYH
Download sequence
Identical sequences B2GV62 Q91YJ4
NP_001102898.1.100692 NP_001102898.1.4139 10116.ENSRNOP00000025213 ENSRNOP00000025213 ENSRNOP00000025213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]