SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025413 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025413
Domain Number 1 Region: 21-228
Classification Level Classification E-value
Superfamily PHP domain-like 1.45e-43
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025413   Gene: ENSRNOG00000018718   Transcript: ENSRNOT00000025412
Sequence length 268
Comment pep:known chromosome:Rnor_5.0:1:262053598:262076260:-1 gene:ENSRNOG00000018718 transcript:ENSRNOT00000025412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKREIEKPVAVSELFTT
LPIVQGKSRPIKILTRLTIIVTDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPINVAIERGLGFELVYGPAIRDATMRRYTISNALNLMQIC
KGKNVILSSAAERPLEIRGPYDVANLGLLFGLSENEGKAAVSTNCRAAFLHGETRKTAFG
IISTVKKPRSSEAEDESLPACKKAKHEG
Download sequence
Identical sequences D3ZU51
10116.ENSRNOP00000025413 ENSRNOP00000025413 ENSRNOP00000025413 NP_001178012.1.100692 NP_001178012.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]