SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025523 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025523
Domain Number 1 Region: 20-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-91
Family Carbonic anhydrase 0.000000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025523   Gene: ENSRNOG00000023162   Transcript: ENSRNOT00000025523
Sequence length 337
Comment pep:known chromosome:Rnor_5.0:2:217500706:217507185:-1 gene:ENSRNOG00000023162 transcript:ENSRNOT00000025523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFVLLLKVTWILAADGGHHWTYEGPHGQDHWPASYPECGGNAQSPIDIQTDGVIFDPD
LPTVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQKGTLKG
SEHQINSEATAAELHVVHYDSESYGSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSH
LHEVRYKDQKTSVPPFNVRELLPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQ
LEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQVGPLYTTGEMLGLGMGISAG
CLCLLLTIYFIAQKIRRKRLGNRKSVVFTSARATTEA
Download sequence
Identical sequences A2IBE0
10116.ENSRNOP00000025523 ENSRNOP00000025523 ENSRNOP00000025523 NP_001103125.1.100692 NP_001103125.1.4139 XP_006233051.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]