SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025764 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025764
Domain Number 1 Region: 296-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.65e-84
Family Eukaryotic proteases 0.00000000267
Further Details:      
 
Domain Number 2 Region: 102-208
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 210-299
Classification Level Classification E-value
Superfamily Kringle-like 2.92e-29
Family Kringle modules 0.0000311
Further Details:      
 
Domain Number 4 Region: 33-82
Classification Level Classification E-value
Superfamily FnI-like domain 5.86e-20
Family Fibronectin type I module 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025764   Gene: ENSRNOG00000019018   Transcript: ENSRNOT00000025763
Sequence length 559
Comment pep:known chromosome:Rnor_5.0:16:73730256:73754851:-1 gene:ENSRNOG00000019018 transcript:ENSRNOT00000025763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGELLCVLLLCGVAFTLPDQGIHRRFRRGARSYRATCRDEQTQTTYQQHQSWLRPMLRG
NRVEYCRCNSGLAQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDT
RATCFEGQGITYRGTWSTAENGAECINWNSSALSQKPYSARRPNAIKLGLGNHNYCRNPD
RDVKPWCYVFKAGKYTTEFCSTPACPKGPTEDCYVGKGVTYRGTHSFTTSKASCLPWNSM
ILIGKTYTAWRANSQALGLGRHNYCRNPDGDAKPWCHVMKDRKLTWEYCDMSPCSTCGLR
QYKQPQFRIKGGLFTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFVER
FPPHHLKVVLGRTYRVVPGEEEQTFEIEKYIVHKEFDDDTYDNDIALLQLRSDSSQCAQE
SSSVGTACLPDPDVQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLF
NKTITSNMLCAGDTRTGGNQDVHDACQGDSGGPLVCMIDKRMTLLGIISWGLGCGQKDVP
GIYTKVTNYLNWIQDNMKQ
Download sequence
Identical sequences P19637
10116.ENSRNOP00000025764 NP_037283.2.100692 NP_037283.2.4139 XP_008769570.1.100692 ENSRNOP00000025764 ENSRNOP00000025764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]