SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025797 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025797
Domain Number 1 Region: 477-816
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.09e-107
Family PDEase 0.00000195
Further Details:      
 
Domain Number 2 Region: 215-318
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000332
Family Heme-binding PAS domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000025797
Domain Number - Region: 86-153
Classification Level Classification E-value
Superfamily CheY-like 0.000912
Family CheY-related 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025797   Gene: ENSRNOG00000019005   Transcript: ENSRNOT00000025797
Sequence length 823
Comment pep:known chromosome:Rnor_5.0:1:143980406:144101790:1 gene:ENSRNOG00000019005 transcript:ENSRNOT00000025797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAPSIHISDNRVSNPSDSDGEDEDVRVPALRSRQRWSTPPGLVEPQPRDSGASKVSVA
DVQFGPMRFHQDQLQVLLVFTKEDSQCNGFYRACEKAGFKCTVTKEVQTVLACFQDKLHD
IIIIDHRNPRQMDAEAMCRSIRSSKLSENTVIVGVVRRVDKEEVSLMPFLAAGFTRRYIE
NPNVMACYNELLQLAFGEVRSQLKLRACNSVFTALEKSQEAIEITSEDHIIQYANPAFET
TMGYQSGELIGKELAQVPINEKKGDLLDAINSCVTIDKEWQGVYHTQKKNGDNIQQNVKI
IPVIGQGGKIRHYVSIIRVCNGSNKVETTTECVQTDSQTDSQAGKHKDRRKHSMDVKAVS
SRTSEVSNQRRHSSLARIHSMMIEAPITKVINILSAAQENSPVSVTEALNHVLDILRTTE
LYSPQFNTEDDPHATDLVGGLMSDGLRRFSGNEYTLATKSLRPSSSQLAVPISLHDIPPR
IAQVIENEEQWDFDIFELEAATQNRPLIYLGLKTFARFEICEFLQCSEATLKSWFQIIES
NYHSSNPYHNSTHAADVLHATAYFLSRNKLKDTLDRLDEVAALIAATIHDVDHPGRTNSF
LCNAGKELAVLYNDTAVLESHHAALAFQLTLENDKCNIFKNTDRNDYRTLRQSIIDMVLA
TEMTKHFEHVNKFINSINKPLKAQKNEVQETGRSLEDIRAMVRTPESRTLIKRMMIKCAD
VSNPCRPLEHCIEWAARISEEYFSQTDEEKQLDLPVVMPVFDRNTCSIPKSQISFIDYFI
TDMFDAWDAFVYLPNLMRHLEDNFKYWKGLDEKELCTLRPPPE
Download sequence
Identical sequences Q76KC6
10116.ENSRNOP00000025797 ENSRNOP00000025797 NP_942062.1.100692 NP_942062.1.4139 XP_006229500.1.100692 ENSRNOP00000025797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]