SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026711 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026711
Domain Number 1 Region: 468-713
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.06e-60
Family Eukaryotic proteases 0.0000698
Further Details:      
 
Domain Number 2 Region: 375-472
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-35
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 3 Region: 190-275
Classification Level Classification E-value
Superfamily Kringle-like 4.11e-34
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 4 Region: 287-374
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-31
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 5 Region: 98-190
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-30
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 6 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 8.04e-17
Family Hairpin loop containing domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026711   Gene: ENSRNOG00000019680   Transcript: ENSRNOT00000026711
Sequence length 716
Comment pep:known chromosome:Rnor_5.0:8:116211797:116216367:1 gene:ENSRNOG00000019680 transcript:ENSRNOT00000026711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLAQCSRALGQRSPLNDFQLLRGTELRNLLHPVVPGPWQEDVADAEECARRC
GPLLDCRAFHYNMSSHGCQLLPWTQHSLRAQLHHSSLCDLFQKKDYVRTCIMDNGASYRG
TVARTADGLPCQAWSRRFPNDHKYTPTPKNGLEENFCRNPDGDPRGPWCYTTNRSVRFQS
CGIKSCREAVCVWCNGEDYRGEVDVTESGRECQRWDLQHPHSHPFHPEKFPDKALKDNYC
RNPDASERPWCYTTDPNVEREFCDLPSCGPNLPPTTKGSKSQQRNKVKASNCFRGKGEDY
RGTTNTTSAGVPCQRWDAQNPHQHRFVPEKYACKDLRENFCRNPDGSEAPWCFTSRPGLR
VAFCYQIPRCTEEVVPEGCYHGSGEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAPH
AGLEANFCRNPDGDSHGPWCYTLDPETLFDYCALKRCDDDQPPSILDPPVQVQFEKCGKR
VDQSNRLRVVGGHPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCIWSCHDPLTGYE
VWLGTINQNPQPGEANLQRVSVAKTVCGPAGSQLVLLKLERPVILNHHVARICLPPEQYV
VPPGTNCEIAGWGESKGTSNSTVLHVAKMKVISSQECNVKYRRRVQESEICTEGLLAPTG
ACEGDYGGPLACYTHDCWVLQGLIIPNRVCARPRWPAIFTRVSVFVDWINKVVQLE
Download sequence
Identical sequences P70521
ENSRNOP00000026711 ENSRNOP00000026711 10116.ENSRNOP00000026711 NP_077328.1.100692 NP_077328.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]