SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027040 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027040
Domain Number 1 Region: 216-343
Classification Level Classification E-value
Superfamily TPR-like 2.66e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 2 Region: 84-213
Classification Level Classification E-value
Superfamily FKBP-like 1.79e-23
Family FKBP immunophilin/proline isomerase 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027040   Gene: ENSRNOG00000019944   Transcript: ENSRNOT00000027040
Sequence length 403
Comment pep:known chromosome:Rnor_5.0:16:20501666:20508369:-1 gene:ENSRNOG00000019944 transcript:ENSRNOT00000027040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWAEPSEPAAQLLCGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPG
ALAREFLAATEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPTGSSRPLKGQVVTVHLQMS
LENGTRVQEEPELAFTLGDCDVIQALDLSVPLMHVGETAMVTADSKYCYGPQGSRSPYIP
PHAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIK
AITSNAKVDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKAL
FRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKMLG
NPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Download sequence
Identical sequences Q3B7U9
ENSRNOP00000027040 NP_001032257.1.100692 NP_001032257.1.4139 ENSRNOP00000027040 10116.ENSRNOP00000027040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]