SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027119 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027119
Domain Number 1 Region: 220-301
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000183
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 81-151
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000126
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000027119
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 
Domain Number - Region: 442-554
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00745
Family Apolipoprotein A-I 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027119   Gene: ENSRNOG00000020009   Transcript: ENSRNOT00000027119
Sequence length 802
Comment pep:known chromosome:Rnor_5.0:1:227192031:227196795:-1 gene:ENSRNOG00000020009 transcript:ENSRNOT00000027119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTMPSALDADRLFRCRFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYL
GFERSELLCKSWYGLLHPEDLAHASSQHYRLLAENGDIQAEMVVRLQAKHGGWTWIYCML
YSDGPEGPITANNYPISDTEAWSLRQQLNSENTQAAYVLGTPAVLPSFSENVFSQEHCSN
PLFTPALGTPRSASFPRAPELGVISTSEELAQPSKELDFSYLPFPARPEPSLQADLSKDL
VCTPPYTPHQPGGCAFLFSLHEPFQTHLPPPSSSLQEQLTPSTVTFSEQLTPSSATFPDP
LTSSLQGQLTESSARSFEEQLTPCTSTFPDQLLPSTATFPEPLGSPTHEQLTPPSTAFQA
HLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYTEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLE
PLGGLEPLNPNLSLSGAGPPVLSLDLKPWKCQELDFLVDPDNLFLEETPVEDIFMDLSTP
DPNGEWGSGDPEAEVPGGTLSPCNNLSPEDHSFLEDLATYETAFETGVSTFPYEGFADEL
HQLQSQVQDSFHEDGSGGEPTF
Download sequence
Identical sequences Q8CJH6
NP_705890.1.100692 NP_705890.1.4139 XP_017444330.1.100692 ENSRNOP00000027119 ENSRNOP00000027119 10116.ENSRNOP00000027119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]