SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027261 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027261
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.83e-22
Family Outer arm dynein light chain 1 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027261   Gene: ENSRNOG00000020124   Transcript: ENSRNOT00000027261
Sequence length 192
Comment pep:known chromosome:Rnor_5.0:1:173188730:173207946:-1 gene:ENSRNOG00000020124 transcript:ENSRNOT00000027261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRDYMNTSVQEPPLDYSFKSVQMIQDLISEEPRTGLRPVKYSKSGKSLTQSLWLNNNV
LNDLKDFNQVVSQLLQHPENLAWIDLSFNDLTTIDPVLTTFFNLSVLYLHGNSIHRLGEV
NKLAVLPRLRSLTLHGNPIEEEKGYRQYVLCNLPRITTFDFSGVTKADRSTAEVWKRMNI
KPKKVRIKQDVL
Download sequence
Identical sequences B6CZ61
NP_001099754.1.100692 NP_001099754.1.4139 XP_006229932.1.100692 XP_006229933.1.100692 XP_006229934.1.100692 XP_006229935.1.100692 XP_006229936.1.100692 XP_006229937.1.100692 XP_017444456.1.100692 10116.ENSRNOP00000027261 ENSRNOP00000027261 ENSRNOP00000027261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]