SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027315 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027315
Domain Number 1 Region: 262-571
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-116
Family Transglutaminase core 0.00000002
Further Details:      
 
Domain Number 2 Region: 113-261
Classification Level Classification E-value
Superfamily E set domains 3.85e-45
Family Transglutaminase N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 585-696
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.25e-29
Family Transglutaminase, two C-terminal domains 0.00059
Further Details:      
 
Domain Number 4 Region: 697-796
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.62e-29
Family Transglutaminase, two C-terminal domains 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027315   Gene: ENSRNOG00000020136   Transcript: ENSRNOT00000027315
Sequence length 824
Comment pep:known chromosome:Rnor_5.0:15:38268114:38281590:-1 gene:ENSRNOG00000020136 transcript:ENSRNOT00000027315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPRSDVGRWGRSPWQPTTPSPEPEPEPEPDRSSRSRRGGGRSFWARCCGCCSCGNRAD
DDWGPEPSGSRSRGTSSRGGGSRGGDSRGRDSRGGRRPESRGSGVNAAGDGTIREGMLVV
NGVDLLCSRSDQNRREHHTDEFEYDELILRRGQPFHIILFLNREYESSDRIALELLIGNN
PEVGKGTHVIIPVGKGGSGGWKAQVTKTNGHNLTLRVHTSPNAIIGKFQFTVRTRSEAGE
FQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQ
FDHGVLDACLYILDRRGMPYGGRGDPVSVSRVVSAMVNSLDDNGVLIGNWTGDYSRGTNP
SAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLT
MDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCC
GPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAI
NSNMREDITHIYKHPEGSEAERKAVEKAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQ
DLTVSVVLTNRGSSRRTVKLHLYLCVTYYTGVSGPTFKETKKEVVLAPGASDTVAMPVAY
KEYKPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIV
FKNPLPITLTNVVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDS
PQLSQVHGVIQVDVAPSSGGRGFSEAVGDSRSGENIPMAFRGGA
Download sequence
Identical sequences P23606
ENSRNOP00000027315 10116.ENSRNOP00000027315 NYSGRC-IgSF-ENSRNOP00000027315 ENSRNOP00000027315 NP_113847.1.100692 NP_113847.1.4139 XP_006252076.1.100692 XP_008768913.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]