SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027507 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027507
Domain Number 1 Region: 332-430
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.96e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027507   Gene: ENSRNOG00000020254   Transcript: ENSRNOT00000027506
Sequence length 1257
Comment pep:known chromosome:Rnor_5.0:9:98231204:98273371:-1 gene:ENSRNOG00000020254 transcript:ENSRNOT00000027506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYVDFSPSPTSPTQEPGEPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDSGK
ELRMLVESSNTHPSPDDTFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLRELKVHL
PADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYTMEQVEGIT
SEYIVKNSDMFAVAVSLVSGKILYISNQVAPIFHCKKDAFSDAKFVEFLAPHDVSVFHSY
TTPYKLPPWSVSSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQK
GAASQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLI
ETPVLVQLHPSDRPLMLAIHKKILQASGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWS
RKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGY
GSLGSNGSHEHLMSQTSSSDSNGQEESHWRRSGIFKTSGKSQSKSHFSPESGGQKEASVA
EMQSSPPAQVRSVTTMERDSSGASLPKASFPEELTYKSQPPCSYQQISCLDSVIRYLESC
NEAATLKRKCEFPANIPSRKATVSPGLHSGEAARSSKVTSHTEVSAHLSSLALPGKAESV
VSLTSQCSYSSTIVHVGDKKPQPELETVEDVASGPESQDDAAGGLSQEKGSLQKLGLTKE
VLAAHTQREEQGFLQRFREVSRLGALQAHCQNYLQERSRAPASDRGLRNASGIESSWKKT
GKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLVGLNATAWSPSDTSQSSCPSAPFPAPVP
AYPLPVFPAPGIVSTPGTVVAPPAAAHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAF
MLPSYPFPPATPNLPQAFFPSQPHFPAHPTLASEITPASQAEFPSRTSMLRQPCACPVTP
PAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPESSTGAAGTLGTTGTAASGLDCTSGA
SRDRQPKAPPTCSEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLG
SSSLGCDTSRSGAGSSDTSHTSKYFGSIDSSENNHKAKMITDTEESEQFIKYVLQDPIWL
LMANTDDNIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPHFTEGQRRELREVHPWVHTGG
LPTAIDVTGCVYCESEEKGNLCLPYEEDSPSLGLCDTSEAKEEESGQLANPRKEAQT
Download sequence
Identical sequences Q9Z301
ENSRNOP00000027507 NP_113866.1.100692 NP_113866.1.4139 XP_006245538.1.100692 XP_017452107.1.100692 ENSRNOP00000027507 10116.ENSRNOP00000027507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]