SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027578 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027578
Domain Number 1 Region: 414-528,648-785
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.25e-67
Family Phosphate binding protein-like 0.000000106
Further Details:      
 
Domain Number 2 Region: 33-392
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.88e-36
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027578   Gene: ENSRNOG00000020310   Transcript: ENSRNOT00000027578
Sequence length 979
Comment pep:known chromosome:Rnor_5.0:1:83137817:83207039:-1 gene:ENSRNOG00000020310 transcript:ENSRNOT00000027578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAELLLLLIVAFANPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLVLRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYPGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFVVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
AHGGPQRLLDDPGPPGGPRPQAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGTPAEAT
SPPRPRPGPTGPRELTEHE
Download sequence
Identical sequences Q61626 Q63273
NP_032194.2.92730 NP_113696.1.100692 NP_113696.1.4139 XP_021074315.1.100879 ENSMUSP00000003468 ENSMUSP00000003468 ENSRNOP00000027578 ENSRNOP00000027578 10090.ENSMUSP00000003468 10116.ENSRNOP00000027578 ENSMUSP00000003468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]