SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027992 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027992
Domain Number 1 Region: 29-487
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-92
Family ALDH-like 0.00000252
Further Details:      
 
Domain Number 2 Region: 516-767
Classification Level Classification E-value
Superfamily ALDH-like 1.19e-43
Family ALDH-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027992   Gene: ENSRNOG00000020623   Transcript: ENSRNOT00000027992
Sequence length 802
Comment pep:known chromosome:Rnor_5.0:1:102203197:102216266:-1 gene:ENSRNOG00000020623 transcript:ENSRNOT00000027992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRIQPSTREIFTTLEYGPVPESHACALAWLDTHNRLLGHYVNGMWLKPEHRNPAPCQ
DPITGENLASCLQAEAEDISAAVEAARITFKTWSQLPGTARGQHLTRLAKVIQKHQRLLW
TLESLVTGRAVREVRDGDIPLAQQLLHYHALQAHAQDSALADWEPLGVIGLILPTSFSFL
DMMWRVCPALAMGCTVVALVPPSFPTPLLLAQLAGELGSFPGILNVVCGPVSLGPVLASQ
PGVQKVAFCGAVEEGRALRQTLAGRGATLGLALGTESLLLLTDSADVDSAVEGVVDAVWS
DRSLGGLRLLIQESVWDEAMKRLQARMAQIRSGKGLDGAVDMGARGAAARDLAQSFVDEA
QSQGGQVFQAGDMPSNSPFFSPTLVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALAN
GTPRGGSASVWSERLGQALELGYGLQVGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDG
LYEYLQLLGTPYRESFLCESLNYDTFGLAVSSSLPSGPETGPSPAPPYGLFVRGRFQSPG
TQSSRPIKDSSGKVSSYVAEGGAKDIRGAVEAAHQAAPGWGAQSPRARASLLWALAAALE
RRKQVLAAQLERHGAAPTVAETEVELSVRRLQTWATRVQDQGQTLQVTGLRGPVLRLREP
LGVLAVVCPDEWPMLAFVSLLAPALAHGNAVVLVPSGSCPLLALEACQDIAALFPAGLVN
VVTGDRDHLTRCLALHQDVQAMWYFGSAQGSQFVEWASAGNLKPVWVNRDFPRAWDVEVQ
GSEQELSLHAARTKALWLPMGD
Download sequence
Identical sequences Q3T1L0
ENSRNOP00000027992 ENSRNOP00000027992 NP_001028878.1.100692 NP_001028878.1.4139 10116.ENSRNOP00000027992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]