SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028540 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028540
Domain Number 1 Region: 44-300
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.16e-65
Family Carbonic anhydrase 0.00000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028540   Gene: ENSRNOG00000021017   Transcript: ENSRNOT00000028540
Sequence length 328
Comment pep:known chromosome:Rnor_5.0:1:102761012:102766123:1 gene:ENSRNOG00000021017 transcript:ENSRNOT00000028540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGAARLSAPQALVLWAALGAAAHIGPAPDPEDWWSYKENLQGNFVPGPPFWGLVNAAWS
LCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPASRPVVNVS
GGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNLSAASRGPNG
LAILSLFVNVAGSSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGS
LSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNGRPLQPLAHRALR
GNRDPRHPERRCRGPNYRLHVDGGPHGR
Download sequence
Identical sequences Q811X3
ENSRNOP00000028540 ENSRNOP00000028540 NP_783639.1.100692 NP_783639.1.4139 10116.ENSRNOP00000028540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]