SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028640 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028640
Domain Number 1 Region: 41-85
Classification Level Classification E-value
Superfamily LysM domain 0.0000000405
Family LysM domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028640   Gene: ENSRNOG00000021099   Transcript: ENSRNOT00000028640
Sequence length 227
Comment pep:known chromosome:Rnor_5.0:2:215799038:215804338:1 gene:ENSRNOG00000021099 transcript:ENSRNOT00000028640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSRQPPLGGSGLLRGSRARSYGSLVQSSCSPVRERRLEHQLEPGDTLAGLALKYGVT
MEQIKRTNRLYTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEENDGEEEVRPSKDEIGSS
SGKRKNQGSASSQPKGTGLPPHQGTSTPSHDLSASDFLKKLDSQISLSKKAAAQKLRKGE
SGVPEEDTGLYPSSPRMQQRAVLGPVPLTRTSRTQTLRDQEDEIFKL
Download sequence
Identical sequences Q5HZA4
10116.ENSRNOP00000028640 NP_001019473.1.100692 NP_001019473.1.4139 ENSRNOP00000028640 ENSRNOP00000028640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]