SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028793 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028793
Domain Number 1 Region: 3-164
Classification Level Classification E-value
Superfamily E set domains 6.09e-19
Family Arrestin/Vps26-like 0.029
Further Details:      
 
Domain Number 2 Region: 159-299
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000637
Family Arrestin/Vps26-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028793   Gene: ENSRNOG00000021201   Transcript: ENSRNOT00000028793
Sequence length 394
Comment pep:known chromosome:Rnor_5.0:2:218170012:218173900:1 gene:ENSRNOG00000021201 transcript:ENSRNOT00000028793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMFKKIKSFEVVFNDPEKVYGSGEKVAGRVTVEVCEVTRVKAVRILACGVAKVLWMQGS
QQCKQTLDYLRYEDTLLLEDQPTGENEMVIMRPGNKYEYKFGFELPQGPLGTSFKGKYGC
VDYWVKAFLDRPSQPTQEAKKNFEVMDLVDVNTPDLMAPVSAKKEKKVSCMFIPDGRVSV
SARIDRKGFCEGDDISIHADFENTCSRIVVPKAAIVARHTYLANGQTKVLTQKLSSVRGN
HIISGTCASWRGKSLRVQKIRPSILGCNILRVEYSLLIYVSVPGSKKVILDLPLVIGSRS
GLSSRTSSMASRTSSEMSWIDLNIPDTPEAPPCYMDVIPEDHRLESPTTPLLDDVDDSQD
SPIFMYAPEFQFMPPPTYTEVDPCVLNNNNNNVQ
Download sequence
Identical sequences Q5M7W1
ENSRNOP00000028793 NP_001008767.1.100692 NP_001008767.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]