SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000029819 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000029819
Domain Number 1 Region: 4-228
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-86
Family Ubiquitin carboxyl-terminal hydrolase UCH-L 0.00000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000029819   Gene: ENSRNOG00000046120   Transcript: ENSRNOT00000028960
Sequence length 230
Comment pep:known chromosome:Rnor_5.0:3:177158973:177200824:-1 gene:ENSRNOG00000046120 transcript:ENSRNOT00000028960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMEPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSALK
KFLEESVAMSPEERARHLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIAVVHVDGHL
YELDGRKPFPINHGKTSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
Download sequence
Identical sequences D4ABI6
ENSRNOP00000012842 ENSRNOP00000029819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]