SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030766 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030766
Domain Number 1 Region: 475-1003
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.13e-144
Family alpha-mannosidase, C-terminal domain 0.0000000000075
Further Details:      
 
Domain Number 2 Region: 51-384
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.67e-121
Family alpha-mannosidase 0.0000000000758
Further Details:      
 
Domain Number 3 Region: 387-491
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 4.9e-28
Family alpha-mannosidase, domain 2 0.0000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030766   Gene: ENSRNOG00000023910   Transcript: ENSRNOT00000037699
Sequence length 1009
Comment pep:known chromosome:Rnor_5.0:19:37172460:37191890:1 gene:ENSRNOG00000023910 transcript:ENSRNOT00000037699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGSLAPGVRAGGGNTGWLWMSSCNLGLPVLSISFLIWLLLAAPGAQAAGYKTCPTTKP
GMLNVHLLPHTHDDVGWLKTVDQYYYGIMSDVQHASVQYILDSVIYSLLNDPTRRFIYVE
MAFFSRWWKQQTNVTQDAVRNLVRQGRLEFVNGGWVMNDEAATHYGAIVDQMTLGLRFLQ
DTFGSDGLPRVAWHIDPFGHSREQASLFAQMGFDGFFLGRIDYQDKFNRKRKLKMEELWR
ASASLKPPAADLFTGVLPNNYNPPKDLCWDVLCTDPPVVDDPTSPEFNANKLVDYFLNLA
SSQKKYYRTNHTVMTMGSDFQYENANMWFKNMDKLIRLVNEQQANGSKVHVLYSTPSCYL
WELNKANLTWTVKEDDFFPYADGPHMFWTGYFSSRPALKRYERLSYNFLQVCNQLEALVG
PEAKVGPYGSGDSAPLNEAMAVLQHHDAVTGTARQNVVNDYAKQLAAGWGPCEVLVSNAL
ARLSLYKQNFSFCREINISICPASQTSEHFRVIIYNPVGRKVDLMVRLPVSEGIFLVKDP
NDRRISSNVVMVPSAYSKTYQWELLFPASVPALGFSIYSVNKMSGHNHQAHNLTARPKKS
KSRVLVIENKYIRATFDSDTGLLRKIENLEQNISLPVRQGFFWYNASAGDEESPQASGAY
IFRPSHRKPLPVSHWAQVTLVKTNLVQEVHQNFSAWCSQVIRLYEGQRHLELEWTVGPIP
VKDDWGKEVISRFNTPMRTRGQFFTDSNGREILKRRDDFRPTWTLNQTEPVAGNYYPVNT
RIYITDGHMQLTVLTDRSQGGSSLLDGSLELMVHRRLLVDDERGVAEPLLETDTGDKVRG
RHLVILSSVSDAAARHRLLAEQEVLAPQVVLAHGGSSPYHSQAPKMQFSALRRELPPQVH
LLTLARWGPKMLLLRLEHQFAVKEDSNRNLSSPVTLNLQNLFKTFTINYLQETTLAANQP
LSRVSRLKWMTDTGPISYPAPSRLDPTSITLQPMQIRTFLASVQWQRLI
Download sequence
Identical sequences Q6P762
NP_955436.1.100692 NP_955436.1.4139 10116.ENSRNOP00000030766 ENSRNOP00000030766 ENSRNOP00000030766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]