SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030968 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000030968
Domain Number - Region: 13-35
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000113
Family Retrovirus zinc finger-like domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030968   Gene: ENSRNOG00000024853   Transcript: ENSRNOT00000029462
Sequence length 79
Comment pep:novel chromosome:Rnor_5.0:2:54058585:54066232:1 gene:ENSRNOG00000024853 transcript:ENSRNOT00000029462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICISGCNKDNVRAGCRKCGYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEESEELN
KLQALQEKSKPWLLSIVLF
Download sequence
Identical sequences ENSRNOP00000030968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]