SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031323 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031323
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.62e-99
Family Carbonic anhydrase 0.0000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031323   Gene: ENSRNOG00000021323   Transcript: ENSRNOT00000038546
Sequence length 262
Comment pep:known chromosome:Rnor_5.0:2:108055053:108086130:-1 gene:ENSRNOG00000021323 transcript:ENSRNOT00000038546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLSWGYDEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGSYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
Download sequence
Identical sequences B5DFG6
ENSRNOP00000031323 10116.ENSRNOP00000031323 ENSRNOP00000031323 NP_001128465.1.100692 NP_001128465.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]