SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031478 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031478
Domain Number 1 Region: 200-310,423-573
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.04e-56
Family Phosphate binding protein-like 0.00000816
Further Details:      
 
Domain Number 2 Region: 3-186
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000132
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031478   Gene: ENSRNOG00000023300   Transcript: ENSRNOT00000033838
Sequence length 771
Comment pep:known_by_projection chromosome:Rnor_5.0:16:9920690:10248222:1 gene:ENSRNOG00000023300 transcript:ENSRNOT00000033838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLQAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNN
HRISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKP
WNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSE
KGLNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKAL
GFKYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMD
YSVGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPR
PSASATLHSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTV
SRMDSPVRTFQDLSKQLEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGA
DNCVSNPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGS
PYRDLFSQRILELQDTGDLDVLKQKWWPHTGRCDLTSHSSAQTDGKSLKLHSFAGVFCIL
AIGLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRINSLMDEDIAHKQISPASI
ELSALEMGGLAPSQALEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSS
ATMPSIQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences F1LUR6
ENSRNOP00000031478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]