SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031505 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031505
Domain Number 1 Region: 56-292
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.62e-65
Family Alanine racemase-like, N-terminal domain 0.000000243
Further Details:      
 
Domain Number 2 Region: 259-411
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.23e-34
Family Eukaryotic ODC-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031505   Gene: ENSRNOG00000024788   Transcript: ENSRNOT00000033929
Sequence length 418
Comment pep:novel chromosome:Rnor_5.0:5:152151354:152161965:-1 gene:ENSRNOG00000024788 transcript:ENSRNOT00000033929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPSEGRREPLGVTESLWPSEPITLGPETSARQLVLKKIQDLSISGHQDPFMVADLDVL
ASRHQTFLQALPRVWPFYAVKCNNRPSLLLVLAALGTGFDCASQGELEQVLGLGVAPSRI
IFANPCKAVSHIQYAARCGVQLLTFDSEEELTKLARHHPGARLILRIQTLGGRSTFPLHT
KFGARLLACGRLLQVARELGLAVVGASFHVGSDCHTPQSYRQAIADCHRVFEMGCKAGHQ
MSLLDLGGGFPGIEGSEAKFEEMARVVNAALAQYFPEGTGVEVIAEPGRFYAESVCTAAV
NIIAKKASLEPGGHRKLAYYLNEGHYGAFRIFLRDPVPRIPIVVKELPSDPHLFPCTLYG
PTCDAFDRLFSTEVQLPELDVGDWLVFPDMGAYRSTMSSTFNGFPITTVYDAMSPQLR
Download sequence
Identical sequences ENSRNOP00000031505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]