SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032283 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032283
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Ribosomal proteins S24e, L23 and L15e 4.32e-94
Family L15e 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032283   Gene: ENSRNOG00000025212   Transcript: ENSRNOT00000038919
Sequence length 204
Comment pep:novel chromosome:Rnor_5.0:12:14262077:14262990:1 gene:ENSRNOG00000025212 transcript:ENSRNOT00000038919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKAQRLGYKAKQGYV
IYRIRVRSGGHKRPVPKGATYSKPVYHGVNQLKFARSLQSVAEERAGRHCGALRVLKSYW
VGEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRVLGKGHKF
HHTIGGSRRAAWGRRNTLQLHRYR
Download sequence
Identical sequences ENSRNOP00000032283 XP_006221318.1.4139 XP_006248964.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]