SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032674 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032674
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Histone-fold 3.69e-24
Family TBP-associated factors, TAFs 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032674   Gene: ENSRNOG00000020527   Transcript: ENSRNOT00000038138
Sequence length 205
Comment pep:known chromosome:Rnor_5.0:1:227733127:227735764:-1 gene:ENSRNOG00000020527 transcript:ENSRNOT00000038138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSR
NAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHTDGDKGPRRGRKPGSSGRK
NGGTGSKSKDKKLSGTDSEQEDESEDTDTDGEEETPQAPPQASHPPAHFQSPPTPFMPFT
SPLPLPPAPPGPSAPEAEDEEDYDS
Download sequence
Identical sequences A0JPP1
ENSRNOP00000032674 NP_001071136.1.100692 NP_001071136.1.4139 10116.ENSRNOP00000032674 ENSRNOP00000032674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]