SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032936 from Rattus norvegicus 76_5.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032936
Domain Number 1 Region: 85-651
Classification Level Classification E-value
Superfamily Urocanase 6.8e-225
Family Urocanase 0.0000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032936   Gene: ENSRNOG00000043404   Transcript: ENSRNOT00000038251
Sequence length 676
Comment pep:known_by_projection chromosome:Rnor_5.0:4:186786154:186816038:1 gene:ENSRNOG00000043404 transcript:ENSRNOT00000038251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLQELCSGLPLRPLPENRGRWAGVPHAPVRTPDLSPEEEQLALRNALRYFPPDVQKLL
ALEFAQELRQFGHIYMYRFCPSIEMRAYPIEQYPCRTRAAAAIMHMIMNNLDPAVAQFPQ
ELVTYGGNGQVFSNWAQFWLTMSYLSKMTEEQTLVMYSGHPLGLFPSSSHAPRLVITNGM
VIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAGRRYLGIEDLA
GKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALVKRHQQGWLMEVTDSLDHCIARL
REARKKKEVLSLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLS
FSEAQSLMSSNPAAFKNLVQESLRRHISAINRLAQEKFFFWDYGNAFLLEAQRAGADVEK
KGANKTEFRYPSYVQHIMGDIFSQGFGPFRWVCTSGNPQDLTVTDHLATSVLEKAIADGV
KASVKLQYMDNIRWIREAAKHQLVVGSQARILYSDQKGRVAIAVAINQAIASGKIKAPVV
LSRDHHDVSGTDSPFRETSNIYDGSAFCADMAVQNFVGDACRGATWVALHNGGGVGWGEV
INGGFGLVLDGTPEAEQKARMMLSWDVSNGVARRCWSGNPKAYEIICQTMQENSGLVVTL
PHEVADEQVLRQVLRL
Download sequence
Identical sequences D3ZIC2
XP_001066120.2.100692 ENSRNOP00000032936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]